90
|
GenScript corporation
biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide Biotinylated Human (Ggqdvt{Py}Aqlhsltrlreate) Or Murine (Ggqdvt{Py}Aqlcsrtlrqgaaas) Pirb Derived Phosphopeptide, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide/product/GenScript corporation Average 90 stars, based on 1 article reviews
biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Biologica Environmental Services
n-terminal biotinylated peptides top 1, top 2, t26, t26qn and peptide with heatmap-derived sequence N Terminal Biotinylated Peptides Top 1, Top 2, T26, T26qn And Peptide With Heatmap Derived Sequence, supplied by Biologica Environmental Services, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/n-terminal biotinylated peptides top 1, top 2, t26, t26qn and peptide with heatmap-derived sequence/product/Biologica Environmental Services Average 90 stars, based on 1 article reviews
n-terminal biotinylated peptides top 1, top 2, t26, t26qn and peptide with heatmap-derived sequence - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Amersham Life Sciences Inc
polyclonal biotinylated sheep antibody to rat ig for detection of rat-derived mabs goh3 and 4c12 Polyclonal Biotinylated Sheep Antibody To Rat Ig For Detection Of Rat Derived Mabs Goh3 And 4c12, supplied by Amersham Life Sciences Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/polyclonal biotinylated sheep antibody to rat ig for detection of rat-derived mabs goh3 and 4c12/product/Amersham Life Sciences Inc Average 90 stars, based on 1 article reviews
polyclonal biotinylated sheep antibody to rat ig for detection of rat-derived mabs goh3 and 4c12 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
CEM Corporation
biotinylated ba derivatives Biotinylated Ba Derivatives, supplied by CEM Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated ba derivatives/product/CEM Corporation Average 90 stars, based on 1 article reviews
biotinylated ba derivatives - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
CPC Scientific
biotinylated peptide derived human bim (residues 51-76 Biotinylated Peptide Derived Human Bim (Residues 51 76, supplied by CPC Scientific, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated peptide derived human bim (residues 51-76/product/CPC Scientific Average 90 stars, based on 1 article reviews
biotinylated peptide derived human bim (residues 51-76 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Biacore
biotinylated egfr derived dodecapeptides based sequence surrounding y1068 Biotinylated Egfr Derived Dodecapeptides Based Sequence Surrounding Y1068, supplied by Biacore, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated egfr derived dodecapeptides based sequence surrounding y1068/product/Biacore Average 90 stars, based on 1 article reviews
biotinylated egfr derived dodecapeptides based sequence surrounding y1068 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Amersham Life Sciences Inc
biotinylated peptide derived from histone h1 Biotinylated Peptide Derived From Histone H1, supplied by Amersham Life Sciences Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated peptide derived from histone h1/product/Amersham Life Sciences Inc Average 90 stars, based on 1 article reviews
biotinylated peptide derived from histone h1 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
PiChem GmbH
biotinylated baffr derived peptide (minibr3) Biotinylated Baffr Derived Peptide (Minibr3), supplied by PiChem GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated baffr derived peptide (minibr3)/product/PiChem GmbH Average 90 stars, based on 1 article reviews
biotinylated baffr derived peptide (minibr3) - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Rapp Polymere GmbH
biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs Biotinylated Peg Derivative With A Terminal Biotin Biotin Conh Peg O C 3 H 6 Conhs, supplied by Rapp Polymere GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs/product/Rapp Polymere GmbH Average 90 stars, based on 1 article reviews
biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Cayman Chemical
biotinylated derivatives Biotinylated Derivatives, supplied by Cayman Chemical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated derivatives/product/Cayman Chemical Average 90 stars, based on 1 article reviews
biotinylated derivatives - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
HyTest
biotinylated- and fitc-conjugated derivatives of anti-v ab (clone val3) Biotinylated And Fitc Conjugated Derivatives Of Anti V Ab (Clone Val3), supplied by HyTest, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated- and fitc-conjugated derivatives of anti-v ab (clone val3)/product/HyTest Average 90 stars, based on 1 article reviews
biotinylated- and fitc-conjugated derivatives of anti-v ab (clone val3) - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin Biotinylated Napi2b Derived Peptide Qinvtvpstanctspslcwtdgiqnwtmkn Biotin, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin/product/GenScript corporation Average 90 stars, based on 1 article reviews
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |