90
|
GenScript corporation
biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide Biotinylated Human (Ggqdvt{Py}Aqlhsltrlreate) Or Murine (Ggqdvt{Py}Aqlcsrtlrqgaaas) Pirb Derived Phosphopeptide, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+human++ggqdvt+py+aqlhsltrlreate++or+murine++ggqdvt+py+aqlcsrtlrqgaaas++pirb+derived+phosphopeptide/pmc07666139-238-20-25 Average 90 stars, based on 1 article reviews
biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
BIOSYNTAN gmbh
biotinylated peptide derived from rad7 Biotinylated Peptide Derived From Rad7, supplied by BIOSYNTAN gmbh, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+peptide+derived+from+rad7/us11529356-2955-11-16 Average 90 stars, based on 1 article reviews
biotinylated peptide derived from rad7 - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
Biomedal Inc
peptides (native and deamidated) and terminal modifications (i.e. biotinylated peptides) derived from gliadin 8-mer sequence Peptides (Native And Deamidated) And Terminal Modifications (I.E. Biotinylated Peptides) Derived From Gliadin 8 Mer Sequence, supplied by Biomedal Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/peptides++native+and+deamidated++and+terminal+modifications++i+e++biotinylated+peptides++derived+from+gliadin+8+mer+sequence/pmc03838339-229-1-21 Average 90 stars, based on 1 article reviews
peptides (native and deamidated) and terminal modifications (i.e. biotinylated peptides) derived from gliadin 8-mer sequence - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
CPC Scientific
biotinylated peptide derived human bim (residues 51-76 Biotinylated Peptide Derived Human Bim (Residues 51 76, supplied by CPC Scientific, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+peptide+derived+human+bim++residues+51+76/us10494381-302-6-13 Average 90 stars, based on 1 article reviews
biotinylated peptide derived human bim (residues 51-76 - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
Promega
biotinylated–vezatin fusion protein (aa 346- 779 derived from vezatin 2.4 isoform) Biotinylated–Vezatin Fusion Protein (Aa 346 779 Derived From Vezatin 2.4 Isoform), supplied by Promega, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+vezatin+fusion+protein++aa+346++779+derived+from+vezatin+2+4+isoform+/pm16199027-105-1-28 Average 90 stars, based on 1 article reviews
biotinylated–vezatin fusion protein (aa 346- 779 derived from vezatin 2.4 isoform) - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
CEM Corporation
biotinylated ba derivative 150 Biotinylated Ba Derivative 150, supplied by CEM Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+ba+derivative+150/10__3390_slash_molecules24020355-861-9-34 Average 90 stars, based on 1 article reviews
biotinylated ba derivative 150 - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
PiChem GmbH
biotinylated baffr derived peptide (minibr3 Biotinylated Baffr Derived Peptide (Minibr3, supplied by PiChem GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+baffr+derived+peptide++minibr3/us08106163-61-0-5 Average 90 stars, based on 1 article reviews
biotinylated baffr derived peptide (minibr3 - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin Biotinylated Napi2b Derived Peptide Qinvtvpstanctspslcwtdgiqnwtmkn Biotin, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+napi2b+derived+peptide+qinvtvpstanctspslcwtdgiqnwtmkn+biotin/us11786605-1403-0-4 Average 90 stars, based on 1 article reviews
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
CEM Corporation
biotinylated ba derivatives Biotinylated Ba Derivatives, supplied by CEM Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+ba+derivatives/10__3390_slash_molecules24020355-834-4-18 Average 90 stars, based on 1 article reviews
biotinylated ba derivatives - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
Rapp Polymere GmbH
biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs Biotinylated Peg Derivative With A Terminal Biotin Biotin Conh Peg O C 3 H 6 Conhs, supplied by Rapp Polymere GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+peg+derivative+with+a+terminal+biotin+biotin+conh+peg+o+c+3+h+6++conhs/pmc08533374-36-6-17 Average 90 stars, based on 1 article reviews
biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
UltraLink LLC
affinity column met-derived biotinylated phosphopeptide comprising residues 998–1007 Affinity Column Met Derived Biotinylated Phosphopeptide Comprising Residues 998–1007, supplied by UltraLink LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/affinity+column+met+derived+biotinylated+phosphopeptide+comprising+residues+998+1007/10__1042_slash_bj3360235-156-30-37 Average 90 stars, based on 1 article reviews
affinity column met-derived biotinylated phosphopeptide comprising residues 998–1007 - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |
90
|
BIOSYNTAN gmbh
biotinylated peptide derived from rad17 Biotinylated Peptide Derived From Rad17, supplied by BIOSYNTAN gmbh, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/biotinylated+derivatives/biotinylated+peptide+derived+from+rad17/us09993484-2951-11-16 Average 90 stars, based on 1 article reviews
biotinylated peptide derived from rad17 - by Bioz Stars,
2026-09
90/100 stars
|
Buy from Supplier |