biotinylated derivatives Search Results


90
GenScript corporation biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide
Biotinylated Human (Ggqdvt{Py}Aqlhsltrlreate) Or Murine (Ggqdvt{Py}Aqlcsrtlrqgaaas) Pirb Derived Phosphopeptide, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide/product/GenScript corporation
Average 90 stars, based on 1 article reviews
biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Biologica Environmental Services n-terminal biotinylated peptides top 1, top 2, t26, t26qn and peptide with heatmap-derived sequence
N Terminal Biotinylated Peptides Top 1, Top 2, T26, T26qn And Peptide With Heatmap Derived Sequence, supplied by Biologica Environmental Services, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/n-terminal biotinylated peptides top 1, top 2, t26, t26qn and peptide with heatmap-derived sequence/product/Biologica Environmental Services
Average 90 stars, based on 1 article reviews
n-terminal biotinylated peptides top 1, top 2, t26, t26qn and peptide with heatmap-derived sequence - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Amersham Life Sciences Inc polyclonal biotinylated sheep antibody to rat ig for detection of rat-derived mabs goh3 and 4c12
Polyclonal Biotinylated Sheep Antibody To Rat Ig For Detection Of Rat Derived Mabs Goh3 And 4c12, supplied by Amersham Life Sciences Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/polyclonal biotinylated sheep antibody to rat ig for detection of rat-derived mabs goh3 and 4c12/product/Amersham Life Sciences Inc
Average 90 stars, based on 1 article reviews
polyclonal biotinylated sheep antibody to rat ig for detection of rat-derived mabs goh3 and 4c12 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
CEM Corporation biotinylated ba derivatives
Biotinylated Ba Derivatives, supplied by CEM Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated ba derivatives/product/CEM Corporation
Average 90 stars, based on 1 article reviews
biotinylated ba derivatives - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
CPC Scientific biotinylated peptide derived human bim (residues 51-76
Biotinylated Peptide Derived Human Bim (Residues 51 76, supplied by CPC Scientific, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated peptide derived human bim (residues 51-76/product/CPC Scientific
Average 90 stars, based on 1 article reviews
biotinylated peptide derived human bim (residues 51-76 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Biacore biotinylated egfr derived dodecapeptides based sequence surrounding y1068
Biotinylated Egfr Derived Dodecapeptides Based Sequence Surrounding Y1068, supplied by Biacore, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated egfr derived dodecapeptides based sequence surrounding y1068/product/Biacore
Average 90 stars, based on 1 article reviews
biotinylated egfr derived dodecapeptides based sequence surrounding y1068 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Amersham Life Sciences Inc biotinylated peptide derived from histone h1
Biotinylated Peptide Derived From Histone H1, supplied by Amersham Life Sciences Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated peptide derived from histone h1/product/Amersham Life Sciences Inc
Average 90 stars, based on 1 article reviews
biotinylated peptide derived from histone h1 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
PiChem GmbH biotinylated baffr derived peptide (minibr3)
Biotinylated Baffr Derived Peptide (Minibr3), supplied by PiChem GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated baffr derived peptide (minibr3)/product/PiChem GmbH
Average 90 stars, based on 1 article reviews
biotinylated baffr derived peptide (minibr3) - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Rapp Polymere GmbH biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs
Biotinylated Peg Derivative With A Terminal Biotin Biotin Conh Peg O C 3 H 6 Conhs, supplied by Rapp Polymere GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs/product/Rapp Polymere GmbH
Average 90 stars, based on 1 article reviews
biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Cayman Chemical biotinylated derivatives
Biotinylated Derivatives, supplied by Cayman Chemical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated derivatives/product/Cayman Chemical
Average 90 stars, based on 1 article reviews
biotinylated derivatives - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
HyTest biotinylated- and fitc-conjugated derivatives of anti-v ab (clone val3)
Biotinylated And Fitc Conjugated Derivatives Of Anti V Ab (Clone Val3), supplied by HyTest, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated- and fitc-conjugated derivatives of anti-v ab (clone val3)/product/HyTest
Average 90 stars, based on 1 article reviews
biotinylated- and fitc-conjugated derivatives of anti-v ab (clone val3) - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
GenScript corporation biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin
Biotinylated Napi2b Derived Peptide Qinvtvpstanctspslcwtdgiqnwtmkn Biotin, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin/product/GenScript corporation
Average 90 stars, based on 1 article reviews
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

Image Search Results